Lineage for d1vg5a_ (1vg5 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534233Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 534257Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 534258Family a.5.2.1: UBA domain [46935] (11 proteins)
  6. 534274Protein Rhomboid family protein At3g58460 [116828] (1 species)
  7. 534275Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116829] (1 PDB entry)
  8. 534276Domain d1vg5a_: 1vg5 A: [113640]

Details for d1vg5a_

PDB Entry: 1vg5 (more details)

PDB Description: Solution Structure of RSGI RUH-014, a UBA domain from Arabidopsis cDNA

SCOP Domain Sequences for d1vg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana)}
gssgssgsrqapianaavlpqsqgrvaaseeqiqklvamgfdrtqvevalaaadddltva
veilmsqsgpssg

SCOP Domain Coordinates for d1vg5a_:

Click to download the PDB-style file with coordinates for d1vg5a_.
(The format of our PDB-style files is described here.)

Timeline for d1vg5a_: