Lineage for d1vg5a1 (1vg5 A:8-67)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984758Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1984759Family a.5.2.1: UBA domain [46935] (25 protein domains)
  6. 1984791Protein Rhomboid family protein At3g58460 [116828] (1 species)
  7. 1984792Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116829] (1 PDB entry)
    Uniprot Q8LB17 342-401
  8. 1984793Domain d1vg5a1: 1vg5 A:8-67 [113640]
    Other proteins in same PDB: d1vg5a2, d1vg5a3

Details for d1vg5a1

PDB Entry: 1vg5 (more details)

PDB Description: Solution Structure of RSGI RUH-014, a UBA domain from Arabidopsis cDNA
PDB Compounds: (A:) rhomboid family protein

SCOPe Domain Sequences for d1vg5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vg5a1 a.5.2.1 (A:8-67) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
srqapianaavlpqsqgrvaaseeqiqklvamgfdrtqvevalaaadddltvaveilmsq

SCOPe Domain Coordinates for d1vg5a1:

Click to download the PDB-style file with coordinates for d1vg5a1.
(The format of our PDB-style files is described here.)

Timeline for d1vg5a1: