SCOPe 2.08: Domain d1vg5a1: 1vg5 A:8-67

Lineage for d1vg5a1 (1vg5 A:8-67)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Rhomboid family protein At3g58460 [116828] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116829] (1 PDB entry)
   Uniprot Q8LB17 342-401

8. Domain d1vg5a1: 1vg5 A:8-67 [113640]
   Other proteins in same PDB: d1vg5a2, d1vg5a3

Details for d1vg5a1

PDB Entry: 1vg5

PDB Description: solution structure of rsgi ruh-014, a uba domain from arabidopsis cdna

PDB Compounds: (A:) rhomboid family protein

SCOPe Domain Sequences for d1vg5a1:

Sequence; same for both SEQRES and ATOM records:

>d1vg5a1 a.5.2.1 (A:8-67) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
srqapianaavlpqsqgrvaaseeqiqklvamgfdrtqvevalaaadddltvaveilmsq

Timeline for d1vg5a1:

• d1vg5a1 first appeared in SCOP 1.71, called d1vg5a_
  
• d1vg5a1 appears in SCOPe 2.07