SCOPe 2.07: Domain d1vfjc_: 1vfj C:

Lineage for d1vfjc_ (1vfj C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein PII (product of glnB) [54915] (8 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries)
   Uniprot P83820

8. Domain d1vfjc_: 1vfj C: [113639]
   structural genomics target

Details for d1vfjc_

PDB Entry: 1vfj, 1.7 Å

PDB Description: crystal structure of tt1020 from thermus thermophilus hb8

PDB Compounds: (C:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d1vfjc_:

Sequence, based on SEQRES records:

>d1vfjc_ d.58.5.1 (C:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeed

Sequence, based on observed residues (ATOM records):

>d1vfjc_ d.58.5.1 (C:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghelhekvrleigvsepfvkptveai
lkaartgevgdgkifvlpvekvyrirtgeed

Timeline for d1vfjc_:

• d1vfjc_ first appeared in SCOP 1.71
  
• d1vfjc_ appears in SCOPe 2.06
  
• d1vfjc_ appears in the current release, SCOPe 2.08