SCOP 1.73: Domain d1vfjb_: 1vfj B:

Lineage for d1vfjb_ (1vfj B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (3 proteins)

6. Protein PII (product of glnB) [54915] (5 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries)

8. Domain d1vfjb_: 1vfj B: [113638]

Details for d1vfjb_

PDB Entry: 1vfj, 1.7 Å

PDB Description: crystal structure of tt1020 from thermus thermophilus hb8

PDB Compounds: (B:) nitrogen regulatory protein p-II

SCOP Domain Sequences for d1vfjb_:

Sequence, based on SEQRES records:

>d1vfjb_ d.58.5.1 (B:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeed

Sequence, based on observed residues (ATOM records):

>d1vfjb_ d.58.5.1 (B:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghgmelhekvrleigvsepfvkptve
ailkaartgevgdgkifvlpvekvyrirtgeed

Timeline for d1vfjb_:

• d1vfjb_ first appeared in SCOP 1.71
  
• d1vfjb_ appears in SCOP 1.75
  
• d1vfjb_ appears in the current release, SCOPe 2.08