Lineage for d1vfja_ (1vfj A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557429Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2557435Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 2557476Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries)
    Uniprot P83820
  8. 2557477Domain d1vfja_: 1vfj A: [113637]
    structural genomics target

Details for d1vfja_

PDB Entry: 1vfj (more details), 1.7 Å

PDB Description: crystal structure of tt1020 from thermus thermophilus hb8
PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d1vfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfja_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq

SCOPe Domain Coordinates for d1vfja_:

Click to download the PDB-style file with coordinates for d1vfja_.
(The format of our PDB-style files is described here.)

Timeline for d1vfja_: