SCOPe 2.06: Domain d1vfja_: 1vfj A:

Lineage for d1vfja_ (1vfj A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein PII (product of glnB) [54915] (8 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries)
   Uniprot P83820

8. Domain d1vfja_: 1vfj A: [113637]
   structural genomics target

Details for d1vfja_

PDB Entry: 1vfj, 1.7 Å

PDB Description: crystal structure of tt1020 from thermus thermophilus hb8

PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d1vfja_:

Sequence; same for both SEQRES and ATOM records:

>d1vfja_ d.58.5.1 (A:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq

Timeline for d1vfja_:

• d1vfja_ first appeared in SCOP 1.71
  
• d1vfja_ appears in SCOPe 2.05
  
• d1vfja_ appears in SCOPe 2.07
  
• d1vfja_ appears in the current release, SCOPe 2.08