Lineage for d1veka1 (1vek A:8-78)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309372Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2309396Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2309397Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2309473Protein Ubiquitin isopeptidase T [116826] (1 species)
  7. 2309474Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116827] (2 PDB entries)
    Uniprot Q9LJT6 594-665; Q8L6Y1 651-710
  8. 2309475Domain d1veka1: 1vek A:8-78 [113636]
    Other proteins in same PDB: d1veka2, d1veka3
    Structural genomics target

Details for d1veka1

PDB Entry: 1vek (more details)

PDB Description: solution structure of rsgi ruh-011, a uba domain from arabidopsis cdna
PDB Compounds: (A:) ubiquitin-specific protease 14, putative

SCOPe Domain Sequences for d1veka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veka1 a.5.2.1 (A:8-78) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
geellpdgvpeevmesaqpvaneeivaqlvsmgfsqlhcqkaaintsnagveeamnwlls
hmddpdidapi

SCOPe Domain Coordinates for d1veka1:

Click to download the PDB-style file with coordinates for d1veka1.
(The format of our PDB-style files is described here.)

Timeline for d1veka1: