Lineage for d1veha1 (1veh A:8-86)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947439Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 2947440Family d.52.8.1: NifU C-terminal domain-like [117917] (3 proteins)
    Pfam PF01106
  6. 2947441Protein HIRA-interacting protein 5, HIRIP5 [117918] (1 species)
  7. 2947442Species Mouse (Mus musculus) [TaxId:10090] [117919] (1 PDB entry)
    Uniprot Q9QZ23 106-185
  8. 2947443Domain d1veha1: 1veh A:8-86 [113635]
    Other proteins in same PDB: d1veha2, d1veha3
    Structural genomics target

Details for d1veha1

PDB Entry: 1veh (more details)

PDB Description: solution structure of rsgi ruh-018, a nifu-like domain of hirip5 protein from mouse cdna
PDB Compounds: (A:) NifU-like protein HIRIP5

SCOPe Domain Sequences for d1veha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veha1 d.52.8.1 (A:8-86) HIRA-interacting protein 5, HIRIP5 {Mouse (Mus musculus) [TaxId: 10090]}
seeddevvamikelldtrirptvqedggdviyrgfedgivrlklqgsctscpssiitlks
giqnmlqfyipevegveqv

SCOPe Domain Coordinates for d1veha1:

Click to download the PDB-style file with coordinates for d1veha1.
(The format of our PDB-style files is described here.)

Timeline for d1veha1: