Lineage for d1vega_ (1veg A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534233Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 534257Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 534258Family a.5.2.1: UBA domain [46935] (11 proteins)
  6. 534271Protein NEDD8 ultimate buster-1 (Nub1) [116824] (1 species)
  7. 534272Species Mouse (Mus musculus) [TaxId:10090] [116825] (1 PDB entry)
  8. 534273Domain d1vega_: 1veg A: [113634]
    Structural genomics target

Details for d1vega_

PDB Entry: 1veg (more details)

PDB Description: solution structure of rsgi ruh-012, a uba domain from mouse cdna

SCOP Domain Sequences for d1vega_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus)}
gssgssgnphmwwlqdadpennsrqaspsqesinqlvymgfdtvvaeaalrvfggnvqla
aqtlahhggslppdlqfsgpssg

SCOP Domain Coordinates for d1vega_:

Click to download the PDB-style file with coordinates for d1vega_.
(The format of our PDB-style files is described here.)

Timeline for d1vega_: