Lineage for d1vega1 (1veg A:8-77)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696068Protein NEDD8 ultimate buster-1 (Nub1) [116824] (1 species)
  7. 2696069Species Mouse (Mus musculus) [TaxId:10090] [116825] (1 PDB entry)
    Uniprot P54729 469-540
  8. 2696070Domain d1vega1: 1veg A:8-77 [113634]
    Other proteins in same PDB: d1vega2, d1vega3
    Structural genomics target

Details for d1vega1

PDB Entry: 1veg (more details)

PDB Description: solution structure of rsgi ruh-012, a uba domain from mouse cdna
PDB Compounds: (A:) NEDD8 ultimate buster-1

SCOPe Domain Sequences for d1vega1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vega1 a.5.2.1 (A:8-77) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]}
nphmwwlqdadpennsrqaspsqesinqlvymgfdtvvaeaalrvfggnvqlaaqtlahh
ggslppdlqf

SCOPe Domain Coordinates for d1vega1:

Click to download the PDB-style file with coordinates for d1vega1.
(The format of our PDB-style files is described here.)

Timeline for d1vega1: