Lineage for d1vega1 (1veg A:8-77)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984758Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1984759Family a.5.2.1: UBA domain [46935] (25 protein domains)
  6. 1984788Protein NEDD8 ultimate buster-1 (Nub1) [116824] (1 species)
  7. 1984789Species Mouse (Mus musculus) [TaxId:10090] [116825] (1 PDB entry)
    Uniprot P54729 469-540
  8. 1984790Domain d1vega1: 1veg A:8-77 [113634]
    Other proteins in same PDB: d1vega2, d1vega3
    Structural genomics target

Details for d1vega1

PDB Entry: 1veg (more details)

PDB Description: Solution Structure of RSGI RUH-012, a UBA Domain from Mouse cDNA
PDB Compounds: (A:) NEDD8 ultimate buster-1

SCOPe Domain Sequences for d1vega1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vega1 a.5.2.1 (A:8-77) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]}
nphmwwlqdadpennsrqaspsqesinqlvymgfdtvvaeaalrvfggnvqlaaqtlahh
ggslppdlqf

SCOPe Domain Coordinates for d1vega1:

Click to download the PDB-style file with coordinates for d1vega1.
(The format of our PDB-style files is described here.)

Timeline for d1vega1: