Lineage for d1ve7b2 (1ve7 B:322-581)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 590154Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 590155Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 590940Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein)
    closely related to the prolyl peptidase and DPP6 domains (scop_fa 53496 and 82497)
  6. 590941Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species)
  7. 590942Species Aeropyrum pernix [TaxId:56636] [117713] (2 PDB entries)
  8. 590946Domain d1ve7b2: 1ve7 B:322-581 [113633]
    Other proteins in same PDB: d1ve7a1, d1ve7b1
    complexed with 4np, gol

Details for d1ve7b2

PDB Entry: 1ve7 (more details), 2.7 Å

PDB Description: Crystal structure of an acylpeptide hydrolase/esterase from Aeropyrum pernix K1 in complex with p-nitrophenyl phosphate

SCOP Domain Sequences for d1ve7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ve7b2 c.69.1.33 (B:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix}
lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf
aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi
mgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr
srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm
edavkillpavfflatqrer

SCOP Domain Coordinates for d1ve7b2:

Click to download the PDB-style file with coordinates for d1ve7b2.
(The format of our PDB-style files is described here.)

Timeline for d1ve7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ve7b1