SCOPe 2.01: Domain d1ve7a2: 1ve7 A:322-581

Lineage for d1ve7a2 (1ve7 A:322-581)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein)
   closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497)

6. Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [117713] (7 PDB entries)
   Uniprot Q9YBQ2

8. Domain d1ve7a2: 1ve7 A:322-581 [113631]
   Other proteins in same PDB: d1ve7a1, d1ve7b1
   complexed with 4np, gol

Details for d1ve7a2

PDB Entry: 1ve7, 2.7 Å

PDB Description: Crystal structure of an acylpeptide hydrolase/esterase from Aeropyrum pernix K1 in complex with p-nitrophenyl phosphate

PDB Compounds: (A:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d1ve7a2:

Sequence; same for both SEQRES and ATOM records:

>d1ve7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}
lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf
aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi
mgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr
srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm
edavkillpavfflatqrer

Timeline for d1ve7a2:

• d1ve7a2 first appeared in SCOP 1.71
  
• d1ve7a2 appears in SCOP 1.75
  
• d1ve7a2 appears in SCOPe 2.02
  
• d1ve7a2 appears in the current release, SCOPe 2.08