Lineage for d1ve6b2 (1ve6 B:322-581)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 843000Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein)
    closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497)
    closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497)
  6. 843001Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species)
  7. 843002Species Aeropyrum pernix [TaxId:56636] [117713] (7 PDB entries)
    Uniprot Q9YBQ2
  8. 843008Domain d1ve6b2: 1ve6 B:322-581 [113629]
    Other proteins in same PDB: d1ve6a1, d1ve6b1
    complexed with bog, gol

Details for d1ve6b2

PDB Entry: 1ve6 (more details), 2.1 Å

PDB Description: crystal structure of an acylpeptide hydrolase/esterase from aeropyrum pernix k1
PDB Compounds: (B:) Acylamino-acid-releasing enzyme

SCOP Domain Sequences for d1ve6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ve6b2 c.69.1.33 (B:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}
lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf
aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi
mgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr
srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm
edavkillpavfflatqrer

SCOP Domain Coordinates for d1ve6b2:

Click to download the PDB-style file with coordinates for d1ve6b2.
(The format of our PDB-style files is described here.)

Timeline for d1ve6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ve6b1