Class b: All beta proteins [48724] (165 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (2 families) |
Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein) |
Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [117288] (5 PDB entries) |
Domain d1ve6b1: 1ve6 B:9-321 [113628] Other proteins in same PDB: d1ve6a2, d1ve6b2 complexed with bog, gol |
PDB Entry: 1ve6 (more details), 2.1 Å
SCOP Domain Sequences for d1ve6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ve6b1 b.69.7.2 (B:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri vslpsgepllegg
Timeline for d1ve6b1: