SCOPe 2.08: Domain d1ve6b1: 1ve6 B:9-321

Lineage for d1ve6b1 (1ve6 B:9-321)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families)

5. Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein)

6. Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [117288] (10 PDB entries)
   Uniprot Q9YBQ2

8. Domain d1ve6b1: 1ve6 B:9-321 [113628]
   Other proteins in same PDB: d1ve6a2, d1ve6b2
   complexed with bog, gol

Details for d1ve6b1

PDB Entry: 1ve6, 2.1 Å

PDB Description: crystal structure of an acylpeptide hydrolase/esterase from aeropyrum pernix k1

PDB Compounds: (B:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d1ve6b1:

Sequence; same for both SEQRES and ATOM records:

>d1ve6b1 b.69.7.2 (B:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}
fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl
dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg
atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr
vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai
twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri
vslpsgepllegg

Timeline for d1ve6b1:

• d1ve6b1 first appeared in SCOP 1.71
  
• d1ve6b1 appears in SCOPe 2.07