Lineage for d1ve6a1 (1ve6 A:9-321)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807549Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 807764Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (2 families) (S)
  5. 807784Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein)
  6. 807785Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species)
  7. 807786Species Aeropyrum pernix [TaxId:56636] [117288] (7 PDB entries)
    Uniprot Q9YBQ2
  8. 807791Domain d1ve6a1: 1ve6 A:9-321 [113626]
    Other proteins in same PDB: d1ve6a2, d1ve6b2

Details for d1ve6a1

PDB Entry: 1ve6 (more details), 2.1 Å

PDB Description: crystal structure of an acylpeptide hydrolase/esterase from aeropyrum pernix k1
PDB Compounds: (A:) Acylamino-acid-releasing enzyme

SCOP Domain Sequences for d1ve6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ve6a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}
fsrivrdverliavekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvl
dphygvgrvilvrdvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftg
atedrvalyaldggglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglr
vfdsgegsfssasispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptai
twlgylpdgrlavvarregrsavfidgerveapqgnhgrvvlwrgklvtshtslstppri
vslpsgepllegg

SCOP Domain Coordinates for d1ve6a1:

Click to download the PDB-style file with coordinates for d1ve6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ve6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ve6a2