Lineage for d1vdvb6 (1vdv B:192-414)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437012Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1437013Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1437083Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 1437123Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 1437124Species Cow (Bos taurus) [TaxId:9913] [56192] (9 PDB entries)
    Uniprot P80457
  8. 1437128Domain d1vdvb6: 1vdv B:192-414 [113625]
    Other proteins in same PDB: d1vdva1, d1vdva2, d1vdva3, d1vdva4, d1vdva5, d1vdvb1, d1vdvb2, d1vdvb3, d1vdvb4, d1vdvb5
    complexed with acy, ca, fad, fes, gol, mos, mte, ysh

Details for d1vdvb6

PDB Entry: 1vdv (more details), 1.98 Å

PDB Description: Bovine Milk Xanthine Dehydrogenase Y-700 Bound Form
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d1vdvb6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdvb6 d.145.1.3 (B:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq
hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt
lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk
ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOPe Domain Coordinates for d1vdvb6:

Click to download the PDB-style file with coordinates for d1vdvb6.
(The format of our PDB-style files is described here.)

Timeline for d1vdvb6: