Lineage for d1vdvb4 (1vdv B:415-528)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607191Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 607324Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 607325Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 607363Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)
  7. 607364Species Cow (Bos taurus) [TaxId:9913] [55453] (5 PDB entries)
  8. 607368Domain d1vdvb4: 1vdv B:415-528 [113623]
    Other proteins in same PDB: d1vdva1, d1vdva2, d1vdva3, d1vdva5, d1vdva6, d1vdvb1, d1vdvb2, d1vdvb3, d1vdvb5, d1vdvb6
    complexed with acy, ca, fad, fes, gol, mos, mte, ysh

Details for d1vdvb4

PDB Entry: 1vdv (more details), 1.98 Å

PDB Description: Bovine Milk Xanthine Dehydrogenase Y-700 Bound Form

SCOP Domain Sequences for d1vdvb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdvb4 d.87.2.1 (B:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus)}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

SCOP Domain Coordinates for d1vdvb4:

Click to download the PDB-style file with coordinates for d1vdvb4.
(The format of our PDB-style files is described here.)

Timeline for d1vdvb4: