Lineage for d1vdvb1 (1vdv B:93-165)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998451Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1998452Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1998453Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 protein domains)
  6. 1998512Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 1998513Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries)
    Uniprot P80457
  8. 1998517Domain d1vdvb1: 1vdv B:93-165 [113620]
    Other proteins in same PDB: d1vdva2, d1vdva3, d1vdva4, d1vdva5, d1vdva6, d1vdvb2, d1vdvb3, d1vdvb4, d1vdvb5, d1vdvb6
    complexed with acy, ca, fad, fes, gol, mos, mte, ysh

Details for d1vdvb1

PDB Entry: 1vdv (more details), 1.98 Å

PDB Description: Bovine Milk Xanthine Dehydrogenase Y-700 Bound Form
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d1vdvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdvb1 a.56.1.1 (B:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d1vdvb1:

Click to download the PDB-style file with coordinates for d1vdvb1.
(The format of our PDB-style files is described here.)

Timeline for d1vdvb1: