Lineage for d1vdva6 (1vdv A:192-414)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735500Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 735501Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 735569Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (5 proteins)
  6. 735609Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 735610Species Cow (Bos taurus) [TaxId:9913] [56192] (5 PDB entries)
  8. 735613Domain d1vdva6: 1vdv A:192-414 [113619]
    Other proteins in same PDB: d1vdva1, d1vdva2, d1vdva3, d1vdva4, d1vdva5, d1vdvb1, d1vdvb2, d1vdvb3, d1vdvb4, d1vdvb5

Details for d1vdva6

PDB Entry: 1vdv (more details), 1.98 Å

PDB Description: Bovine Milk Xanthine Dehydrogenase Y-700 Bound Form
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOP Domain Sequences for d1vdva6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdva6 d.145.1.3 (A:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq
hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt
lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk
ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOP Domain Coordinates for d1vdva6:

Click to download the PDB-style file with coordinates for d1vdva6.
(The format of our PDB-style files is described here.)

Timeline for d1vdva6: