Lineage for d1vdva4 (1vdv A:415-528)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries)
    Uniprot P80457
  8. Domain d1vdva4: 1vdv A:415-528 [113617]
    Other proteins in same PDB: d1vdva1, d1vdva2, d1vdva3, d1vdva5, d1vdva6, d1vdvb1, d1vdvb2, d1vdvb3, d1vdvb5, d1vdvb6
    complexed with acy, ca, fad, fes, gol, mos, mte, ysh

Details for d1vdva4

PDB Entry: 1vdv (more details), 1.98 Å

PDB Description: Bovine Milk Xanthine Dehydrogenase Y-700 Bound Form
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d1vdva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdva4 d.87.2.1 (A:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

SCOPe Domain Coordinates for d1vdva4 are not available.

Timeline for d1vdva4:

Domains from same chain:
(mouse over for more information)
d1vdva1, d1vdva2, d1vdva3, d1vdva5, d1vdva6
Domains from other chains:
(mouse over for more information)
d1vdvb1, d1vdvb2, d1vdvb3, d1vdvb4, d1vdvb5, d1vdvb6