Lineage for d1vdva3 (1vdv A:537-694)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602004Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 602005Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 602006Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 602050Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 602051Species Cow (Bos taurus) [TaxId:9913] [54671] (5 PDB entries)
  8. 602054Domain d1vdva3: 1vdv A:537-694 [113616]
    Other proteins in same PDB: d1vdva1, d1vdva2, d1vdva4, d1vdva5, d1vdva6, d1vdvb1, d1vdvb2, d1vdvb4, d1vdvb5, d1vdvb6

Details for d1vdva3

PDB Entry: 1vdv (more details), 1.98 Å

PDB Description: Bovine Milk Xanthine Dehydrogenase Y-700 Bound Form

SCOP Domain Sequences for d1vdva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdva3 d.41.1.1 (A:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus)}
kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi
pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa
kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa

SCOP Domain Coordinates for d1vdva3:

Click to download the PDB-style file with coordinates for d1vdva3.
(The format of our PDB-style files is described here.)

Timeline for d1vdva3: