Lineage for d1vdva2 (1vdv A:3-92)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598835Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 598929Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (12 proteins)
  6. 599009Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 599010Species Cow (Bos taurus) [TaxId:9913] [54319] (5 PDB entries)
  8. 599013Domain d1vdva2: 1vdv A:3-92 [113615]
    Other proteins in same PDB: d1vdva1, d1vdva3, d1vdva4, d1vdva5, d1vdva6, d1vdvb1, d1vdvb3, d1vdvb4, d1vdvb5, d1vdvb6

Details for d1vdva2

PDB Entry: 1vdv (more details), 1.98 Å

PDB Description: Bovine Milk Xanthine Dehydrogenase Y-700 Bound Form

SCOP Domain Sequences for d1vdva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdva2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus)}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

SCOP Domain Coordinates for d1vdva2:

Click to download the PDB-style file with coordinates for d1vdva2.
(The format of our PDB-style files is described here.)

Timeline for d1vdva2: