Lineage for d1vdva1 (1vdv A:93-165)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539215Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 539216Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 539217Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)
  6. 539261Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 539262Species Cow (Bos taurus) [TaxId:9913] [47747] (5 PDB entries)
  8. 539265Domain d1vdva1: 1vdv A:93-165 [113614]
    Other proteins in same PDB: d1vdva2, d1vdva3, d1vdva4, d1vdva5, d1vdva6, d1vdvb2, d1vdvb3, d1vdvb4, d1vdvb5, d1vdvb6

Details for d1vdva1

PDB Entry: 1vdv (more details), 1.98 Å

PDB Description: Bovine Milk Xanthine Dehydrogenase Y-700 Bound Form

SCOP Domain Sequences for d1vdva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdva1 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus)}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOP Domain Coordinates for d1vdva1:

Click to download the PDB-style file with coordinates for d1vdva1.
(The format of our PDB-style files is described here.)

Timeline for d1vdva1: