Lineage for d1vcub_ (1vcu B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565371Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 565372Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 565373Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 565494Protein Sialidase 2 (Neu2) [117274] (1 species)
  7. 565495Species Human (Homo sapiens) [TaxId:9606] [117275] (3 PDB entries)
  8. 565499Domain d1vcub_: 1vcu B: [113611]
    complexed with dan, epe

Details for d1vcub_

PDB Entry: 1vcu (more details), 2.85 Å

PDB Description: structure of the human cytosolic sialidase neu2 in complex with the inhibitor dana

SCOP Domain Sequences for d1vcub_:

Sequence, based on SEQRES records: (download)

>d1vcub_ b.68.1.1 (B:) Sialidase 2 (Neu2) {Human (Homo sapiens)}
maslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdyd
apthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtran
vtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpaya
yrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshl
rarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythpth
swqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandye
eivflmftlkqafpaey

Sequence, based on observed residues (ATOM records): (download)

>d1vcub_ b.68.1.1 (B:) Sialidase 2 (Neu2) {Human (Homo sapiens)}
maslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdyd
apthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtran
vtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpaya
yrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshl
rarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprspaqwllythpthswqr
adlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeivf
lmftlkqafpaey

SCOP Domain Coordinates for d1vcub_:

Click to download the PDB-style file with coordinates for d1vcub_.
(The format of our PDB-style files is described here.)

Timeline for d1vcub_: