Lineage for d1vcua_ (1vcu A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2398434Protein Sialidase 2 (Neu2) [117274] (1 species)
  7. 2398435Species Human (Homo sapiens) [TaxId:9606] [117275] (14 PDB entries)
    Uniprot Q9Y3R4
  8. 2398449Domain d1vcua_: 1vcu A: [113610]
    complexed with dan, epe

Details for d1vcua_

PDB Entry: 1vcu (more details), 2.85 Å

PDB Description: Structure of the human cytosolic sialidase Neu2 in complex with the inhibitor DANA
PDB Compounds: (A:) Sialidase 2

SCOPe Domain Sequences for d1vcua_:

Sequence, based on SEQRES records: (download)

>d1vcua_ b.68.1.1 (A:) Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9606]}
maslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdyd
apthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtran
vtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpaya
yrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshl
rarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythpth
swqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandye
eivflmftlkqafpaey

Sequence, based on observed residues (ATOM records): (download)

>d1vcua_ b.68.1.1 (A:) Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9606]}
maslpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdyd
apthqvqwqaqevvaqarldghrsmnpcplydaqtgtlflffiaipgqvteqqqlqtran
vtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvpaya
yrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaeveqrvvtlnarshlrar
vqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprspaqwllythpthswqradl
gaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmf
tlkqafpaey

SCOPe Domain Coordinates for d1vcua_:

Click to download the PDB-style file with coordinates for d1vcua_.
(The format of our PDB-style files is described here.)

Timeline for d1vcua_: