SCOPe 2.06: Domain d1vcia3: 1vci A:7-245

Lineage for d1vcia3 (1vci A:7-245)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Hypothetical protein PH0022, N-terminal domain [117546] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [117547] (2 PDB entries)
   Uniprot O57758

8. Domain d1vcia3: 1vci A:7-245 [113609]
   Other proteins in same PDB: d1vcia1, d1vcia2
   complexed with atp

Details for d1vcia3

PDB Entry: 1vci, 2.9 Å

PDB Description: Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3 complexed with ATP

PDB Compounds: (A:) sugar-binding transport ATP-binding protein

SCOPe Domain Sequences for d1vcia3:

Sequence, based on SEQRES records:

>d1vcia3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
vikmvevklenltkrfgnftavnklnltikdgeflvllgpsgcgktttlrmiagleepte
griyfgdrdvtylppkdrnismvfqsyavwphmtvyeniafplkikkfpkdeidkrvrwa
aellqieellnrypaqlsggqrqrvavaraivvepdvllmdeplsnldaklrvamraeik
klqqklkvttiyvthdqveamtmgdriavmnrgqllqigsptevylrpnsvfvatfiga

Sequence, based on observed residues (ATOM records):

>d1vcia3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
vikmvevklenltkrfgnftavnklnltikdgeflvllgpsgcgktttlrmiagleepte
griyfgdrdvtylppkdrnismvfqhmtvyeniafplkkfpkdeidkrvrwaaellqiee
llnrypaqlsggqrqrvavaraivvepdvllmdeplsnldaklrvamraeikklqqklkv
ttiyvthdqveamtmgdriavmnrgqllqigsptevylrpnsvfvatfiga

Timeline for d1vcia3:

• d1vcia3 first appeared in SCOP 1.71
  
• d1vcia3 appears in SCOPe 2.05
  
• d1vcia3 appears in SCOPe 2.07
  
• d1vcia3 appears in the current release, SCOPe 2.08