Lineage for d1vcia3 (1vci A:7-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870261Protein Hypothetical protein PH0022, N-terminal domain [117546] (1 species)
  7. 2870262Species Pyrococcus horikoshii [TaxId:53953] [117547] (2 PDB entries)
    Uniprot O57758
  8. 2870264Domain d1vcia3: 1vci A:7-245 [113609]
    Other proteins in same PDB: d1vcia1, d1vcia2
    complexed with atp

Details for d1vcia3

PDB Entry: 1vci (more details), 2.9 Å

PDB Description: Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3 complexed with ATP
PDB Compounds: (A:) sugar-binding transport ATP-binding protein

SCOPe Domain Sequences for d1vcia3:

Sequence, based on SEQRES records: (download)

>d1vcia3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
vikmvevklenltkrfgnftavnklnltikdgeflvllgpsgcgktttlrmiagleepte
griyfgdrdvtylppkdrnismvfqsyavwphmtvyeniafplkikkfpkdeidkrvrwa
aellqieellnrypaqlsggqrqrvavaraivvepdvllmdeplsnldaklrvamraeik
klqqklkvttiyvthdqveamtmgdriavmnrgqllqigsptevylrpnsvfvatfiga

Sequence, based on observed residues (ATOM records): (download)

>d1vcia3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
vikmvevklenltkrfgnftavnklnltikdgeflvllgpsgcgktttlrmiagleepte
griyfgdrdvtylppkdrnismvfqhmtvyeniafplkkfpkdeidkrvrwaaellqiee
llnrypaqlsggqrqrvavaraivvepdvllmdeplsnldaklrvamraeikklqqklkv
ttiyvthdqveamtmgdriavmnrgqllqigsptevylrpnsvfvatfiga

SCOPe Domain Coordinates for d1vcia3:

Click to download the PDB-style file with coordinates for d1vcia3.
(The format of our PDB-style files is described here.)

Timeline for d1vcia3: