Lineage for d1vcia2 (1vci A:304-373)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 560345Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 560429Family b.40.6.3: ABC-transporter additional domain [50338] (3 proteins)
    probably stems out from the biMOP domain
  6. 560443Protein Hypothetical protein PH0022, C-terminal domain [117208] (1 species)
  7. 560444Species Pyrococcus horikoshii [TaxId:70601] [117209] (2 PDB entries)
  8. 560448Domain d1vcia2: 1vci A:304-373 [113608]
    Other proteins in same PDB: d1vcia3
    complexed with atp

Details for d1vcia2

PDB Entry: 1vci (more details), 2.9 Å

PDB Description: Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3 complexed with ATP

SCOP Domain Sequences for d1vcia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcia2 b.40.6.3 (A:304-373) Hypothetical protein PH0022, C-terminal domain {Pyrococcus horikoshii}
hmkrtarligkvdfvealgtdtilhvkfgdelvkvklpghipiepgrevkvimdldmihv
fdkdtekaiv

SCOP Domain Coordinates for d1vcia2:

Click to download the PDB-style file with coordinates for d1vcia2.
(The format of our PDB-style files is described here.)

Timeline for d1vcia2: