![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.6: MOP-like [50331] (4 families) ![]() |
![]() | Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins) probably stems out from the biMOP domain |
![]() | Protein Hypothetical protein PH0022, C-terminal domain [117208] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [117209] (2 PDB entries) Uniprot O57758 |
![]() | Domain d1vcia2: 1vci A:304-373 [113608] Other proteins in same PDB: d1vcia3 complexed with atp fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1vci (more details), 2.9 Å
SCOPe Domain Sequences for d1vcia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcia2 b.40.6.3 (A:304-373) Hypothetical protein PH0022, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} hmkrtarligkvdfvealgtdtilhvkfgdelvkvklpghipiepgrevkvimdldmihv fdkdtekaiv
Timeline for d1vcia2: