Lineage for d1vb5b_ (1vb5 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1395793Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 1395794Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 1395994Family c.124.1.5: IF2B-like [110513] (5 proteins)
    Pfam PF01008; contains extra N-terminal alpha+beta domain (1-126); beta(3)-alpha(5); 3 layers: b/a/a
  6. 1396011Protein Putative eIF-2B subunit 2-like protein PH0440 [117517] (1 species)
  7. 1396012Species Pyrococcus horikoshii [TaxId:53953] [117518] (1 PDB entry)
    Uniprot O58185
  8. 1396014Domain d1vb5b_: 1vb5 B: [113605]

Details for d1vb5b_

PDB Entry: 1vb5 (more details), 2.2 Å

PDB Description: crystal structure analysis of the pyrococcus horikoshii ot3 translation initiation factor eif-2b
PDB Compounds: (B:) translation initiation factor eIF-2B

SCOPe Domain Sequences for d1vb5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vb5b_ c.124.1.5 (B:) Putative eIF-2B subunit 2-like protein PH0440 {Pyrococcus horikoshii [TaxId: 53953]}
lpervleilremkrerikgaswlakkgaeafltlaeeldeslledaimelreevvkvnps
maslynlarfipvtnrrdilksraleflrrmeeakrelasigaqliddgdviithsfsst
vleiirtakerkkrfkviltesspdyeglhlarelefsgiefevitdaqmglfcreasia
ivgadmitkdgyvvnkagtyllalachenaipfyvaaetykfhptlksgdvmlmerdlir
gnvrirnvlfdvtpwkyvrgiitelgivipprdiq

SCOPe Domain Coordinates for d1vb5b_:

Click to download the PDB-style file with coordinates for d1vb5b_.
(The format of our PDB-style files is described here.)

Timeline for d1vb5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vb5a_