Lineage for d1vb5b_ (1vb5 B:)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) 
Family c.124.1.5: IF2B-like [110513] (4 proteins)
Pfam 01008; contains extra N-terminal alpha+beta domain (1-126); beta(3)-alpha(5); 3 layers: b/a/a
Protein Putative eIF-2B subunit 2-like protein PH0440 [117517] (1 species) Species Pyrococcus horikoshii [TaxId:70601] [117518] (1 PDB entry) 
Domain d1vb5b_: 1vb5 B: [113605]
Details for d1vb5b_
PDB Entry: 1vb5 (more details), 2.2 Å
PDB Description: crystal structure analysis of the pyrococcus horikoshii ot3 translation initiation factor eif-2b
SCOP Domain Sequences for d1vb5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vb5b_ c.124.1.5 (B:) Putative eIF-2B subunit 2-like protein PH0440 {Pyrococcus horikoshii}
lpervleilremkrerikgaswlakkgaeafltlaeeldeslledaimelreevvkvnps
maslynlarfipvtnrrdilksraleflrrmeeakrelasigaqliddgdviithsfsst
vleiirtakerkkrfkviltesspdyeglhlarelefsgiefevitdaqmglfcreasia
ivgadmitkdgyvvnkagtyllalachenaipfyvaaetykfhptlksgdvmlmerdlir
gnvrirnvlfdvtpwkyvrgiitelgivipprdiq
SCOP Domain Coordinates for d1vb5b_:
Click to download the PDB-style file with coordinates for d1vb5b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vb5b_:
- d1vb5b_ is new in SCOP 1.71
- d1vb5b_ appears in SCOP 1.73
- d1vb5b_ appears in the current release, SCOPe 2.08
View in 3D
