Lineage for d1vb5a_ (1vb5 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595310Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 595311Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) (S)
  5. 595419Family c.124.1.5: IF2B-like [110513] (4 proteins)
    Pfam 01008; contains extra N-terminal alpha+beta domain (1-126); beta(3)-alpha(5); 3 layers: b/a/a
  6. 595432Protein Putative eIF-2B subunit 2-like protein PH0440 [117517] (1 species)
  7. 595433Species Pyrococcus horikoshii [TaxId:70601] [117518] (1 PDB entry)
  8. 595434Domain d1vb5a_: 1vb5 A: [113604]

Details for d1vb5a_

PDB Entry: 1vb5 (more details), 2.2 Å

PDB Description: crystal structure analysis of the pyrococcus horikoshii ot3 translation initiation factor eif-2b

SCOP Domain Sequences for d1vb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vb5a_ c.124.1.5 (A:) Putative eIF-2B subunit 2-like protein PH0440 {Pyrococcus horikoshii}
lpervleilremkrerikgaswlakkgaeafltlaeeldeslledaimelreevvkvnps
maslynlarfipvtnrrdilksraleflrrmeeakrelasigaqliddgdviithsfsst
vleiirtakerkkrfkviltesspdyeglhlarelefsgiefevitdaqmglfcreasia
ivgadmitkdgyvvnkagtyllalachenaipfyvaaetykfhptlksgdvmlmerdlir
gnvrirnvlfdvtpwkyvrgiitelgivipprdi

SCOP Domain Coordinates for d1vb5a_:

Click to download the PDB-style file with coordinates for d1vb5a_.
(The format of our PDB-style files is described here.)

Timeline for d1vb5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vb5b_