Lineage for d1vaka_ (1vak A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822375Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)
  6. 2822386Protein Sobemovirus coat protein [88644] (4 species)
  7. 2822399Species SMV (Sesbania mosaic virus) [TaxId:12558] [49624] (5 PDB entries)
    Uniprot Q9EB06
  8. 2822406Domain d1vaka_: 1vak A: [113600]
    deletion mutant
    complexed with ca; mutant

Details for d1vaka_

PDB Entry: 1vak (more details), 3.05 Å

PDB Description: T=1 capsid structure of Sesbania mosaic virus coat protein deletion mutant CP-N(delta)65
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d1vaka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vaka_ b.121.4.7 (A:) Sobemovirus coat protein {SMV (Sesbania mosaic virus) [TaxId: 12558]}
gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
tytiqmieptasalnn

SCOPe Domain Coordinates for d1vaka_:

Click to download the PDB-style file with coordinates for d1vaka_.
(The format of our PDB-style files is described here.)

Timeline for d1vaka_: