Lineage for d1va6b_ (1va6 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. Family d.128.1.4: Glutamate-cysteine ligase [118090] (2 proteins)
    Pfam PF04262
  6. Protein Gamma-glutamylcysteine synthetase GshA [118091] (1 species)
  7. Species Escherichia coli [TaxId:562] [118092] (2 PDB entries)
    Uniprot P0A6W9
  8. Domain d1va6b_: 1va6 B: [113599]
    complexed with adp, mg, p2s, p6g

Details for d1va6b_

PDB Entry: 1va6 (more details), 2.1 Å

PDB Description: Crystal structure of Gamma-glutamylcysteine synthetase from Escherichia Coli B complexed with Transition-state analogue
PDB Compounds: (B:) Glutamate--cysteine ligase

SCOPe Domain Sequences for d1va6b_:

Sequence, based on SEQRES records: (download)

>d1va6b_ d.128.1.4 (B:) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
eilreedfvaereaserrqqemeaadtepfavwle

Sequence, based on observed residues (ATOM records): (download)

>d1va6b_ d.128.1.4 (B:) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgadakekisagyfrvi
rnyyrfgwvipylfgaspaisssfltslpfektesgmyylpyatslrlsdlgytnksqsn
lgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapirpkrv
trsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladapemsss
elactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsinggea
yqkvcdelvacfdnpdltfsarilrsmidttgkafaeayrnllreepleilreedfvaer
easerrqqemeaadtepfavwle

SCOPe Domain Coordinates for d1va6b_ are not available.

Timeline for d1va6b_:

Domains from other chains:
(mouse over for more information)
d1va6a_