Lineage for d1va6a_ (1va6 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733061Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 733062Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 733246Family d.128.1.4: Glutamate-cysteine ligase [118090] (1 protein)
    Pfam PF04262
  6. 733247Protein Gamma-glutamylcysteine synthetase GshA [118091] (1 species)
  7. 733248Species Escherichia coli [TaxId:562] [118092] (4 PDB entries)
  8. 733249Domain d1va6a_: 1va6 A: [113598]

Details for d1va6a_

PDB Entry: 1va6 (more details), 2.1 Å

PDB Description: crystal structure of gamma-glutamylcysteine synthetase from escherichia coli b complexed with transition-state analogue
PDB Compounds: (A:) Glutamate--cysteine ligase

SCOP Domain Sequences for d1va6a_:

Sequence, based on SEQRES records: (download)

>d1va6a_ d.128.1.4 (A:) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
eilreedfvaereaserrqqemeaadtepfavwle

Sequence, based on observed residues (ATOM records): (download)

>d1va6a_ d.128.1.4 (A:) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
frvirnyyrfgwvipylfgaspaisssfltslpfektesgmyylpyatslrlsdlgytnk
sqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapir
pkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladape
mssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsin
ggeayqkvcdelvacfdnpdltfsarilrsmidttgkafaeayrnllreepleilreedf
vaereaserrqqemeaadtepfavwle

SCOP Domain Coordinates for d1va6a_:

Click to download the PDB-style file with coordinates for d1va6a_.
(The format of our PDB-style files is described here.)

Timeline for d1va6a_: