Lineage for d1va6a_ (1va6 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538555Family d.128.1.4: Glutamate-cysteine ligase [118090] (2 proteins)
    Pfam PF04262
  6. 2538556Protein Gamma-glutamylcysteine synthetase GshA [118091] (1 species)
  7. 2538557Species Escherichia coli [TaxId:562] [118092] (2 PDB entries)
    Uniprot P0A6W9
  8. 2538558Domain d1va6a_: 1va6 A: [113598]
    complexed with adp, mg, p2s, p6g

Details for d1va6a_

PDB Entry: 1va6 (more details), 2.1 Å

PDB Description: Crystal structure of Gamma-glutamylcysteine synthetase from Escherichia Coli B complexed with Transition-state analogue
PDB Compounds: (A:) Glutamate--cysteine ligase

SCOPe Domain Sequences for d1va6a_:

Sequence, based on SEQRES records: (download)

>d1va6a_ d.128.1.4 (A:) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
frvirnyyrfgwvipylfgaspaisssflqgkptslpfektesgmyylpyatslrlsdlg
ytnksqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienely
apirpkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcala
dapemssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtl
dsinggeayqkvcdelvacfdnpdltfsarilrsmidtgiggtgkafaeayrnllreepl
eilreedfvaereaserrqqemeaadtepfavwle

Sequence, based on observed residues (ATOM records): (download)

>d1va6a_ d.128.1.4 (A:) Gamma-glutamylcysteine synthetase GshA {Escherichia coli [TaxId: 562]}
mipdvsqalawlekhpqalkgiqrgleretlrvnadgtlattghpealgsalthkwittd
faeallefitpvdgdiehmltfmrdlhrytarnmgdermwplsmpsyiaegqdielaqyg
tsntgrfktlyreglknrygalmqtisgvhynfslpmafwqaksgdisgadakekisagy
frvirnyyrfgwvipylfgaspaisssfltslpfektesgmyylpyatslrlsdlgytnk
sqsnlgitfndlyeyvaglkqaiktpseeyakigiekdgkrlqinsnvlqienelyapir
pkrvtrsgespsdallrggieyievrsldinpfspigvdeqqvrfldlfmvwcaladape
mssselactrvnwnrvilegrkpgltlgigcetaqfplpqvgkdlfrdlkrvaqtldsin
ggeayqkvcdelvacfdnpdltfsarilrsmidttgkafaeayrnllreepleilreedf
vaereaserrqqemeaadtepfavwle

SCOPe Domain Coordinates for d1va6a_:

Click to download the PDB-style file with coordinates for d1va6a_.
(The format of our PDB-style files is described here.)

Timeline for d1va6a_: