SCOPe 2.03: Domain d1v9oc_: 1v9o C:

Lineage for d1v9oc_ (1v9o C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein PII (product of glnB) [54915] (7 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Thermus thermophilus [TaxId:274] [102972] (5 PDB entries)
   Uniprot P83820

8. Domain d1v9oc_: 1v9o C: [113597]
   structural genomics target
   complexed with adp

Details for d1v9oc_

PDB Entry: 1v9o, 2 Å

PDB Description: Crystal structure of TT1020 from Thermus thermophilus HB8

PDB Compounds: (C:) nitrogen regulatory protein pii

SCOPe Domain Sequences for d1v9oc_:

Sequence, based on SEQRES records:

>d1v9oc_ d.58.5.1 (C:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeed

Sequence, based on observed residues (ATOM records):

>d1v9oc_ d.58.5.1 (C:) PII (product of glnB) {Thermus thermophilus [TaxId: 274]}
mklivaivrpeklnevlkalfqaevrgltlsrvqghlhekvrleigvsepfvkptveail
kaartgevgdgkifvlpvekvyrirtgeed

Timeline for d1v9oc_:

• d1v9oc_ first appeared in SCOP 1.71
  
• d1v9oc_ appears in SCOPe 2.02
  
• d1v9oc_ appears in SCOPe 2.04
  
• d1v9oc_ appears in the current release, SCOPe 2.08