Lineage for d1v9le2 (1v9l E:4-179)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890284Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2890285Protein Glutamate dehydrogenase [53225] (8 species)
  7. 2890352Species Pyrobaculum islandicum [TaxId:2277] [117471] (1 PDB entry)
    Uniprot Q9Y8I4
  8. 2890357Domain d1v9le2: 1v9l E:4-179 [113592]
    Other proteins in same PDB: d1v9la1, d1v9lb1, d1v9lc1, d1v9ld1, d1v9le1, d1v9lf1
    complexed with nad

Details for d1v9le2

PDB Entry: 1v9l (more details), 2.8 Å

PDB Description: L-glutamate dehydrogenase from Pyrobaculum islandicum complexed with NAD
PDB Compounds: (E:) glutamate dehydrogenase

SCOPe Domain Sequences for d1v9le2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9le2 c.58.1.1 (E:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]}
tgfleyvlnyvkkgvelggfpedfykilsrprrvlivnipvrldgggfevfegyrvqhcd
vlgpykggvrfhpevtladdvalailmtlknslaglpyggakgavrvdpkklsqreleel
srgyaraiapligdvvdipapdvgtnaqimawmvdeyskikgynvpgvftskppel

SCOPe Domain Coordinates for d1v9le2:

Click to download the PDB-style file with coordinates for d1v9le2.
(The format of our PDB-style files is described here.)

Timeline for d1v9le2: