Lineage for d1v9le1 (1v9l E:180-421)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845191Protein Glutamate dehydrogenase [51884] (8 species)
  7. 2845258Species Pyrobaculum islandicum [TaxId:2277] [117436] (1 PDB entry)
    Uniprot Q9Y8I4
  8. 2845263Domain d1v9le1: 1v9l E:180-421 [113591]
    Other proteins in same PDB: d1v9la2, d1v9lb2, d1v9lc2, d1v9ld2, d1v9le2, d1v9lf2
    complexed with nad
    has additional insertions and/or extensions that are not grouped together

Details for d1v9le1

PDB Entry: 1v9l (more details), 2.8 Å

PDB Description: L-glutamate dehydrogenase from Pyrobaculum islandicum complexed with NAD
PDB Compounds: (E:) glutamate dehydrogenase

SCOPe Domain Sequences for d1v9le1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9le1 c.2.1.7 (E:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]}
wgnpvreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviav
sdingvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaa
ienvirgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewv
enlqwyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirg
wi

SCOPe Domain Coordinates for d1v9le1:

Click to download the PDB-style file with coordinates for d1v9le1.
(The format of our PDB-style files is described here.)

Timeline for d1v9le1: