Lineage for d1v9la1 (1v9l A:180-421)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575952Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 575953Protein Glutamate dehydrogenase [51884] (8 species)
  7. 576035Species Pyrobaculum islandicum [TaxId:2277] [117436] (1 PDB entry)
  8. 576036Domain d1v9la1: 1v9l A:180-421 [113583]
    Other proteins in same PDB: d1v9la2, d1v9lb2, d1v9lc2, d1v9ld2, d1v9le2, d1v9lf2

Details for d1v9la1

PDB Entry: 1v9l (more details), 2.8 Å

PDB Description: L-glutamate dehydrogenase from Pyrobaculum islandicum complexed with NAD

SCOP Domain Sequences for d1v9la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum}
wgnpvreyatgfgvavatremakklwggiegktvaiqgmgnvgrwtaywlekmgakviav
sdingvayrkeglnveliqknkgltgpalvelfttkdnaefvknpdaifkldvdifvpaa
ienvirgdnaglvkarlvvegangpttpeaerilyergvvvvpdilanaggvimsylewv
enlqwyiwdeeetrkrlenimvnnvervykrwqrekgwtmrdaaivtaleriynamkirg
wi

SCOP Domain Coordinates for d1v9la1:

Click to download the PDB-style file with coordinates for d1v9la1.
(The format of our PDB-style files is described here.)

Timeline for d1v9la1: