![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily) alpha+beta fold |
![]() | Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) ![]() |
![]() | Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins) |
![]() | Protein Ribonuclease MC1 [55899] (1 species) |
![]() | Species Bitter gourd (Momordica charantia) [TaxId:3673] [55900] (8 PDB entries) Uniprot P23540 |
![]() | Domain d1v9ha1: 1v9h A:1-190 [113582] Other proteins in same PDB: d1v9ha2 protein/RNA complex; complexed with so4, u5p; mutant |
PDB Entry: 1v9h (more details), 2 Å
SCOPe Domain Sequences for d1v9ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v9ha1 d.124.1.1 (A:1-190) Ribonuclease MC1 {Bitter gourd (Momordica charantia) [TaxId: 3673]} fdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish lqsqlntlwpnvlrannqqfwshewtkhgtcsestfnqaaafklavdmrnnydiigalrp haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvevvacfaqdgstlidct rdtcganfif
Timeline for d1v9ha1: