SCOP 1.71: Domain d1v9ha_: 1v9h A:

Lineage for d1v9ha_ (1v9h A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
   alpha+beta fold

4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family)

5. Family d.124.1.1: Ribonuclease Rh-like [55896] (8 proteins)

6. Protein Ribonuclease MC1 [55899] (1 species)

7. Species Bitter gourd (Momordica charantia) [TaxId:3673] [55900] (8 PDB entries)

8. Domain d1v9ha_: 1v9h A: [113582]
   complexed with so4, u5p; mutant

Details for d1v9ha_

PDB Entry: 1v9h, 2 Å

PDB Description: crystal structure of the rnase mc1 mutant y101a in complex with 5'-ump

SCOP Domain Sequences for d1v9ha_:

Sequence; same for both SEQRES and ATOM records:

>d1v9ha_ d.124.1.1 (A:) Ribonuclease MC1 {Bitter gourd (Momordica charantia)}
yvefdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditk
ishlqsqlntlwpnvlrannqqfwshewtkhgtcsestfnqaaafklavdmrnnydiiga
lrphaagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvevvacfaqdgstli
dctrdtcganfif

Timeline for d1v9ha_:

• d1v9ha_ is new in SCOP 1.71
  
• d1v9ha_ appears in SCOP 1.73
  
• d1v9ha_ appears in the current release, SCOPe 2.08, called d1v9ha1