Lineage for d1v9ha1 (1v9h A:1-190)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974241Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 2974242Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) (S)
  5. 2974243Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)
  6. 2974248Protein Ribonuclease MC1 [55899] (1 species)
  7. 2974249Species Bitter gourd (Momordica charantia) [TaxId:3673] [55900] (8 PDB entries)
    Uniprot P23540
  8. 2974258Domain d1v9ha1: 1v9h A:1-190 [113582]
    Other proteins in same PDB: d1v9ha2
    protein/RNA complex; complexed with so4, u5p; mutant

Details for d1v9ha1

PDB Entry: 1v9h (more details), 2 Å

PDB Description: crystal structure of the rnase mc1 mutant y101a in complex with 5'-ump
PDB Compounds: (A:) Ribonuclease MC

SCOPe Domain Sequences for d1v9ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9ha1 d.124.1.1 (A:1-190) Ribonuclease MC1 {Bitter gourd (Momordica charantia) [TaxId: 3673]}
fdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
lqsqlntlwpnvlrannqqfwshewtkhgtcsestfnqaaafklavdmrnnydiigalrp
haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvevvacfaqdgstlidct
rdtcganfif

SCOPe Domain Coordinates for d1v9ha1:

Click to download the PDB-style file with coordinates for d1v9ha1.
(The format of our PDB-style files is described here.)

Timeline for d1v9ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v9ha2