SCOP 1.71: Domain d1v8wa_: 1v8w A:

Lineage for d1v8wa_ (1v8w A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (5 families)

5. Family d.113.1.1: MutT-like [55812] (10 proteins)

6. Protein ADP-ribose pyrophosphatase [64365] (3 species)

7. Species Thermus thermophilus [TaxId:274] [118083] (10 PDB entries)

8. Domain d1v8wa_: 1v8w A: [113580]
   complexed with so4, zn; mutant

Details for d1v8wa_

PDB Entry: 1v8w, 1.66 Å

PDB Description: crystal structure analysis of the adp-ribose pyrophosphatase of e82q mutant, complexed with so4 and zn

SCOP Domain Sequences for d1v8wa_:

Sequence, based on SEQRES records:

>d1v8wa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrqlaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpdedea
ievvwmrpeealerhqrgevefsatglvgvlyyhaflr

Sequence, based on observed residues (ATOM records):

>d1v8wa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrqlaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpaievv
wmrpeealerhqrgevefsatglvgvlyyhaflr

Timeline for d1v8wa_:

• d1v8wa_ is new in SCOP 1.71
  
• d1v8wa_ appears in SCOP 1.73
  
• d1v8wa_ appears in the current release, SCOPe 2.08