Lineage for d1v8ua_ (1v8u A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. Protein ADP-ribose pyrophosphatase [64365] (4 species)
  7. Species Thermus thermophilus [TaxId:274] [118083] (13 PDB entries)
    Uniprot Q84CU3
  8. Domain d1v8ua_: 1v8u A: [113578]
    complexed with mg, so4; mutant

Details for d1v8ua_

PDB Entry: 1v8u (more details), 1.9 Å

PDB Description: Crystal structure analysis of the ADP-ribose pyrophosphatase of E82Q mutant with SO4 and Mg
PDB Compounds: (A:) ADP-ribose pyrophosphatase

SCOPe Domain Sequences for d1v8ua_:

Sequence, based on SEQRES records: (download)

>d1v8ua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrqlaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpdedea
ievvwmrpeealerhqrgevefsatglvgvlyyhaflrg

Sequence, based on observed residues (ATOM records): (download)

>d1v8ua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrqlaeetglsgdltylfsyfvspgftdekthvflaenlkeveaeaievvw
mrpeealerhqrgevefsatglvgvlyyhaflrg

SCOPe Domain Coordinates for d1v8ua_ are not available.

Timeline for d1v8ua_: