Lineage for d1v8na_ (1v8n A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971452Protein ADP-ribose pyrophosphatase [64365] (4 species)
  7. 2971471Species Thermus thermophilus [TaxId:274] [118083] (13 PDB entries)
    Uniprot Q84CU3
  8. 2971477Domain d1v8na_: 1v8n A: [113575]
    complexed with zn
    has additional subdomain(s) that are not in the common domain

Details for d1v8na_

PDB Entry: 1v8n (more details), 1.74 Å

PDB Description: Crystal structure analysis of the ADP-ribose pyrophosphatase complexed with Zn
PDB Compounds: (A:) ADP-ribose pyrophosphatase

SCOPe Domain Sequences for d1v8na_:

Sequence, based on SEQRES records: (download)

>d1v8na_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpdedea
ievvwmrpeealerhqrgevefsatglvgvlyyhaflr

Sequence, based on observed residues (ATOM records): (download)

>d1v8na_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveievvwmrp
eealerhqrgevefsatglvgvlyyhaflr

SCOPe Domain Coordinates for d1v8na_:

Click to download the PDB-style file with coordinates for d1v8na_.
(The format of our PDB-style files is described here.)

Timeline for d1v8na_: