![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein ADP-ribose pyrophosphatase [64365] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [118083] (13 PDB entries) Uniprot Q84CU3 |
![]() | Domain d1v8ma_: 1v8m A: [113574] complexed with apr, gd has additional subdomain(s) that are not in the common domain |
PDB Entry: 1v8m (more details), 1.8 Å
SCOPe Domain Sequences for d1v8ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8ma_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie pgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpdedea ievvwmrpeealerhqrgevefsatglvgvlyyhaflrg
Timeline for d1v8ma_: