Lineage for d1v8ia_ (1v8i A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871095Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 871096Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 871097Family d.113.1.1: MutT-like [55812] (16 proteins)
  6. 871107Protein ADP-ribose pyrophosphatase [64365] (3 species)
  7. 871126Species Thermus thermophilus [TaxId:274] [118083] (11 PDB entries)
    Uniprot Q84CU3
  8. 871129Domain d1v8ia_: 1v8i A: [113572]

Details for d1v8ia_

PDB Entry: 1v8i (more details), 1.76 Å

PDB Description: Crystal Structure Analysis of the ADP-ribose pyrophosphatase
PDB Compounds: (A:) ADP-ribose pyrophosphatase

SCOP Domain Sequences for d1v8ia_:

Sequence, based on SEQRES records: (download)

>d1v8ia_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveahpdedea
ievvwmrpeealerhqrgevefsatglvgvlyyhaflr

Sequence, based on observed residues (ATOM records): (download)

>d1v8ia_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveievvwmrp
eealerhqrgevefsatglvgvlyyhaflr

SCOP Domain Coordinates for d1v8ia_:

Click to download the PDB-style file with coordinates for d1v8ia_.
(The format of our PDB-style files is described here.)

Timeline for d1v8ia_: