Lineage for d1v8bb1 (1v8b B:235-397)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575504Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 575561Protein S-adenosylhomocystein hydrolase [51845] (3 species)
  7. 575566Species Plasmodium falciparum, isolate 3D7 [TaxId:5833] [117431] (1 PDB entry)
  8. 575568Domain d1v8bb1: 1v8b B:235-397 [113566]
    Other proteins in same PDB: d1v8ba2, d1v8bb2, d1v8bc2, d1v8bd2

Details for d1v8bb1

PDB Entry: 1v8b (more details), 2.4 Å

PDB Description: Crystal structure of a hydrolase

SCOP Domain Sequences for d1v8bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8bb1 c.2.1.4 (B:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7}
nvygcrhslpdglmratdflisgkivvicgygdvgkgcassmkglgarvyiteidpicai
qavmegfnvvtldeivdkgdffitctgnvdviklehllkmknnavvgnighfddeiqvne
lfnykgihienvkpqvdritlpngnkiivlargrllnlgcatg

SCOP Domain Coordinates for d1v8bb1:

Click to download the PDB-style file with coordinates for d1v8bb1.
(The format of our PDB-style files is described here.)

Timeline for d1v8bb1: